General Information

  • ID:  hor002223
  • Uniprot ID:  P01308
  • Protein name:  Insulin B chain
  • Gene name:  INS
  • Organism:  Homo sapiens (Human)
  • Family:  Insulin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with INS include Hyperproinsulinemia and Maturity-Onset Diabetes Of The Young, Type 10.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0002020 protease binding; GO:0005158 insulin receptor binding; GO:0005159 insulin-like growth factor receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0042802 identical protein binding
  • GO BP:  GO:0010629 negative regulation of gene expression
  • GO CC:  NA

Sequence Information

  • Sequence:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
  • Length:  30
  • Propeptide:  MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
  • Signal peptide:  MALWMRLLPLLALLALWGPDPAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01308-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002223_AF2.pdbhor002223_ESM.pdb

Physical Information

Mass: 394741 Formula: C158H234N40O42S2
Absent amino acids: DIMW Common amino acids: L
pI: 7.42 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 11
Hydrophobicity: 22 Boman Index: -1648
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 84.33
Instability Index: 984.67 Extinction Coefficient cystines: 3105
Absorbance 280nm: 107.07

Literature

  • PubMed ID:  14426955
  • Title:  Amino-acid Sequence of Human Insulin